Protein coding transcript 250536

• Transcript: Ll_transcript_32703
• CDS coordinates: 55-510 (+)
• Peptide sequence: MELYADTTPRTAENFRALCTGEKGVGRSGKPLHFKGSSFHRVIPNFMCQGGDFTAGNGTGGESIYGAKFEDENFIKKHTGPGILSMANAGPGTNGSQFFICTTKTEWLDGKHVVFGEVVEGLNVVKDIEKVGSSSGKTSRPVTIADCGQLS*
• ORF Type: complete

Annotations of Ll_transcript_32703

• Blastp: Peptidyl-prolyl cis-trans isomerase from Lupinus with 92.05% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase from Lupinus with 92.9% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000347)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412701.1)
• Pfam: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD (PF00160.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;