Protein coding transcript 250545

• Transcript: Ll_transcript_31706
• CDS coordinates: 3-473 (+)
• Peptide sequence: PSRALDPFLVYDIEPKDYFDFLCTQKLTPTQLAVFGIYSNRTCNHSLASPGDLNYPAISVVFPEKKSISSLTIHRTATNVGPPVSKYHVVVSPFKGASLKVVPDTLNFTRKYQKLSYKIIFTSKSKPAEPEFGGLVWKDGVHKVRSPIVITYMAPI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_31706

• Blastp: Subtilisin-like protease SBT1.3 from Arabidopsis with 60.51% of identity
• Blastx: Subtilisin-like protease SBT1.3 from Arabidopsis with 60.51% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: Link to kegg annotations (AT5G51750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452830.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;