Protein coding transcript 2506

• Transcript: Ll_transcript_328927
• CDS coordinates: 37-351 (+)
• Peptide sequence: MSDAGADDVPSAAPVVATGGPMDVNTALQEVLKNALIHDGLAQGLHEAAKALDKRQALLCLLADNCDQPAYKKLVEALCNEHQIPIIKVEDNKKLGEWAGLCKID
• ORF Type: 3prime_partial

Annotations of Ll_transcript_328927

• Blastp: 40S ribosomal protein S12 from Sus with 80% of identity
• Blastx: 40S ribosomal protein S12 from Gallus with 80.68% of identity
• Eggnog: (ribosomal) protein(COG1358)
• Kegg: Link to kegg annotations (397650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020232660.1)
• Pfam: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;