Protein coding transcript 250625

• Transcript: Ll_transcript_32440
• CDS coordinates: 279-1382 (+)
• Peptide sequence: MEFHPHIPISHLDSQWQMKSISSETMEAGVYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLVIATAMMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPREQAGSAGRVALNTLGYPLHPNEPECTYYLRTGQCKFGNTCKFHHPQPSNMILSLRGSPVYPTVQSPTAPGQQSYAGGIANWSRTSYIASPRWQGPSSYTPLVLPQGVVSVPGWSAYSGQMRSISASDSPQQIIGDGQTYGTSRQDEVANAGSQGEYSQFRSGSVPVGFYALQRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPVPDCVLSPIGLPLRPVSGVLAVVFYLLSCFFIALPFIIFYLKWILLFFS*
• ORF Type: complete

Annotations of Ll_transcript_32440

• Blastp: Zinc finger CCCH domain-containing protein ZFN-like from Pisum with 80.66% of identity
• Blastx: Zinc finger CCCH domain-containing protein ZFN-like from Pisum with 80.66% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427978.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;