Transcript | Ll_transcript_5258 |
---|---|
CDS coordinates | 359-1072 (+) |
Peptide sequence | MLHRINTSRSLCAKVFRTKTHFHAAAAFSTSLLFDDTQIQFKESVSQFATENIAPHASKIDHTNYFPKEVNLWKSMGEFNLHGITAPEEYGGLGLGYLYHCIAMEEISRASGSVGLSYGAHSNLCINQLVRNGSPAQKEKYLPKLISGDHVGALAMSEPNSGSDVVSMKCKADRVDGGYVLNGNKMWCTNGPVAQTLVVYAKTNITAGSKGITAFIIEKGMPGYIKLNLDIKLNDLE* |
ORF Type | complete |
Blastp | 2-methylacyl-CoA dehydrogenase, mitochondrial from Solanum with 76.79% of identity |
---|---|
Blastx | Isovaleryl-CoA dehydrogenase, mitochondrial from Solanum with 81.25% of identity |
Eggnog | Dehydrogenase(ENOG410XNMY) |
Kegg | Link to kegg annotations (102589539) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448719.1) |
Pfam | Acyl-CoA dehydrogenase, N-terminal domain (PF02771.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer