Protein coding transcript 250645

• Transcript: Ll_transcript_5269
• CDS coordinates: 509-1117 (+)
• Peptide sequence: MIQFKESVSQFATENIAPHASKIDHTNYFPKEINLWKSMGEFNLHGITAPEEYGGLGLGYLYHCIAMEEISRASGSVGLSYGAHSNLCINQLVRNGSPAQKEKYLPKLISGDHVGALAMSEPNSGSDVVSMKCKADCVDGGYVLNGNKMWCTNGPVAQTLVVYAKTNTAAGSKGITAFIIEKGMPGFSTAQKLDKLGMRGSDT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_5269

• Blastp: Isovaleryl-CoA dehydrogenase, mitochondrial from Oryza sativa with 87.56% of identity
• Blastx: Isovaleryl-CoA dehydrogenase, mitochondrial from Arabidopsis with 88.06% of identity
• Eggnog: Dehydrogenase(ENOG410XNMY)
• Kegg: Link to kegg annotations (4337676)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413615.1)
• Pfam: Acyl-CoA dehydrogenase, N-terminal domain (PF02771.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;