Protein coding transcript 250648

• Transcript: Ll_transcript_5272
• CDS coordinates: 2-397 (+)
• Peptide sequence: IQFKESVSQFATENIASHASKINHTNYIPKEVNLWKSMGEFNLHGITAPEEYGGLGLGYLYHCIAMEEISRASGSVGLSYGAHSNLCINQLVRNGSPAQKEKYLPKVLVLPILILFIISKIHAAFPYCRLS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_5272

• Blastp: Isovaleryl-CoA dehydrogenase, mitochondrial from Oryza sativa with 79.44% of identity
• Blastx: Isovaleryl-CoA dehydrogenase, mitochondrial from Arabidopsis with 84.47% of identity
• Eggnog: Dehydrogenase(ENOG410XNMY)
• Kegg: Link to kegg annotations (4337676)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448719.1)
• Pfam: Acyl-CoA dehydrogenase, N-terminal domain (PF02771.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;