Protein coding transcript 250678

• Transcript: Ll_transcript_6330
• CDS coordinates: 208-819 (+)
• Peptide sequence: MEANTSSYKIILGSSSIARRKILSEMGYQFTILTADIDEKSIRKETPEELVMALAEAKAEAIVQRLHVDDYLKEAEPTLLITCDQVVVYGGVVREKPSSKEEARQFLKDYSGGHAATVGSVLVTNLKTGLRKGEWDRVEIYFNEMPDETIEKLVDEGITLNVAGGLIIEHPLILPFVKEVVGTTDSVMGLPKALTEKLLKEAV*
• ORF Type: complete

Annotations of Ll_transcript_6330

• Blastp: Maf-like protein DDB_G0281937 from Dictyostelium with 38.07% of identity
• Blastx: Maf-like protein DDB_G0281937 from Dictyostelium with 38.07% of identity
• Eggnog: Maf-like protein(COG0424)
• Kegg: Link to kegg annotations (DDB_G0281937)
• CantataDB: Link to cantataDB annotations (CNT0001794)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436915.1)
• Pfam: Maf-like protein (PF02545.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;