Protein coding transcript 250679

• Transcript: Ll_transcript_6331
• CDS coordinates: 208-567 (+)
• Peptide sequence: MEANTSSYKIILGSSSIARRKILSEMGYQFTILTADIDEKSIRKETPEELVMALAEAKANAIISKLQTTSNREGVDEPTILIAADTAEAIVQRLHVDDYLKEAEPTLLITCDQVYIIFF*
• ORF Type: complete

Annotations of Ll_transcript_6331

• Blastp: Maf-like protein DDB_G0281937 from Dictyostelium with 38.75% of identity
• Blastx: Maf-like protein DDB_G0281937 from Dictyostelium with 35.04% of identity
• Eggnog: Maf-like protein(COG0424)
• Kegg: Link to kegg annotations (DDB_G0281937)
• CantataDB: Link to cantataDB annotations (CNT0001794)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436913.1)
• Pfam: Maf-like protein (PF02545.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;