Transcript | Ll_transcript_6331 |
---|---|
CDS coordinates | 208-567 (+) |
Peptide sequence | MEANTSSYKIILGSSSIARRKILSEMGYQFTILTADIDEKSIRKETPEELVMALAEAKANAIISKLQTTSNREGVDEPTILIAADTAEAIVQRLHVDDYLKEAEPTLLITCDQVYIIFF* |
ORF Type | complete |
Blastp | Maf-like protein DDB_G0281937 from Dictyostelium with 38.75% of identity |
---|---|
Blastx | Maf-like protein DDB_G0281937 from Dictyostelium with 35.04% of identity |
Eggnog | Maf-like protein(COG0424) |
Kegg | Link to kegg annotations (DDB_G0281937) |
CantataDB | Link to cantataDB annotations (CNT0001794) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436913.1) |
Pfam | Maf-like protein (PF02545.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer