Protein coding transcript 250702

• Transcript: Ll_transcript_7637
• CDS coordinates: 787-1239 (+)
• Peptide sequence: MCFFATIQSAIFALVYEQNLQAWVVHSPLEFSCCLYAGIGIAVSFFIQTWCISERGPLYCAMFNPLATVITALITVTFMHEELYVGSLVGAIGVIAGLYIVLWGKAKEIEEIKQEKQPNLQDDKISSTIDLEEPLLSENSENVAETKLEP*
• ORF Type: complete

Annotations of Ll_transcript_7637

• Blastp: WAT1-related protein At4g30420 from Arabidopsis with 46.75% of identity
• Blastx: WAT1-related protein At4g28040 from Arabidopsis with 44.25% of identity
• Eggnog: auxin-induced protein(ENOG410ZZXZ)
• Kegg: Link to kegg annotations (AT4G30420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453791.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;