Protein coding transcript 250704

• Transcript: Ll_transcript_7628
• CDS coordinates: 51-497 (+)
• Peptide sequence: MAFMLMLFLLLTGLEMLPVLGILDATAEQSLGVCYGQVANNLPPAPEVIALFNQNGIGRMRIYNPNIPTIEALKGSAIKLSVGVPNEIIQSLATDAAAATQWVQTNIITYAKDVKFQYIVVGNEIMPGNTTGPYVAPKLTLAWHHASNL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_7628

• Blastp: Glucan endo-1,3-beta-glucosidase, acidic isoform GI9 from Nicotiana with 46.43% of identity
• Blastx: Glucan endo-1,3-beta-glucosidase, acidic isoform GI9 from Nicotiana with 53.98% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454307.1)
• Pfam: Glycosyl hydrolases family 17 (PF00332.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;