Protein coding transcript 250753

• Transcript: Ll_transcript_7093
• CDS coordinates: 759-1475 (+)
• Peptide sequence: MSNGGAPSPTPRRRTMLGRTSARKNLSMESIDFPIDDEDEIERLETTRTELQTQIAQEVEANVKLQSHIDKRKKDLQERRLALEQDVARLQEQLRKEKKSRAKSHLEELAFVEVDLTDLERKVEELGTRLNAQLEQNFGSTLDSYNQSEQISSDERKWKNKQDTEDSATSQSDRSISKGTNLGAENENERKAESIPFSNKQPPTSSKKSGSKGEVRQSSDKGRDRDSISNNLEKGKGPE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_7093

• Blastp: Rho GTPase-activating protein REN1 from Arabidopsis with 40% of identity
• Blastx: Rho GTPase-activating protein 7 from Arabidopsis with 36.84% of identity
• Eggnog: rho GTPase activating protein(ENOG410XR4E)
• Kegg: Link to kegg annotations (AT4G24580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416051.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;