Protein coding transcript 250756

• Transcript: Ll_transcript_7115
• CDS coordinates: 1-1293 (+)
• Peptide sequence: DGSVQLLQAAAAANHAQAICITLLEEYNSIFGEGSESPDIYTDTEESGSESEEGTDDDLSYDDEDYDDDEDGSVHESDVDDDLGSESYSETGESQAYDEHDDKDHDHSSPSSKSSGASEEFRVTRPSKSFRGSQPQHQDIKNSKNLRSPTKNACADQSNEPANIAGGVSTDQSTEDNSDFPSASSCIKKSITMSNGGAPSPTPRRRTMLGRTSARKNLSMESIDFPIDDEDEIERLETTRTELQTQIAQEVEANVKLQSHIDKRKKDLQERRLALEQDVARLQEQLRKEKKSRAKSHLEELAFVEVDLTDLERKVEELGTRLNAQLEQNFGSTLDSYNQSEQISSDERKWKNKQDTEDSATSQSDRSISKGTNLGAENENERKAESIPFSNKQPPTSSKKSGSKGEVRQSSDKGRDRDSISNNLEKGKGPE
• ORF Type: internal

Annotations of Ll_transcript_7115

• Blastp: Rho GTPase-activating protein REN1 from Arabidopsis with 40.93% of identity
• Blastx: Rho GTPase-activating protein REN1 from Arabidopsis with 35.98% of identity
• Eggnog: rho GTPase activating protein(ENOG410XR4E)
• Kegg: Link to kegg annotations (AT4G24580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416051.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;