Protein coding transcript 250757

• Transcript: Ll_transcript_7116
• CDS coordinates: 98-760 (+)
• Peptide sequence: MSNGGAPSPTPRRRTMLGRTSARKNLSMESIDFPIDDEDEIERLETTRTELQTQIAQEVEANVKLQSHIDKRKKDLQERRLALEQDVARLQEQLRKEKKSRAKSHLEELAFVEVDLTDLERKVEELGTRLNAQLEQNFGSTLDSYNQSEQISSDERKWKNKQDTEDSATSQSDRSISKGTNLGAENENERKAESIPFSNKQPPTSSKKSGSKGEGANSTPS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_7116

• Blastp: Rho GTPase-activating protein REN1 from Arabidopsis with 40.08% of identity
• Blastx: Rho GTPase-activating protein 7 from Arabidopsis with 36.84% of identity
• Eggnog: rho GTPase activating protein(ENOG410XR4E)
• Kegg: Link to kegg annotations (AT4G24580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416050.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;