Transcript | Ll_transcript_7116 |
---|---|
CDS coordinates | 98-760 (+) |
Peptide sequence | MSNGGAPSPTPRRRTMLGRTSARKNLSMESIDFPIDDEDEIERLETTRTELQTQIAQEVEANVKLQSHIDKRKKDLQERRLALEQDVARLQEQLRKEKKSRAKSHLEELAFVEVDLTDLERKVEELGTRLNAQLEQNFGSTLDSYNQSEQISSDERKWKNKQDTEDSATSQSDRSISKGTNLGAENENERKAESIPFSNKQPPTSSKKSGSKGEGANSTPS |
ORF Type | 3prime_partial |
Blastp | Rho GTPase-activating protein REN1 from Arabidopsis with 40.08% of identity |
---|---|
Blastx | Rho GTPase-activating protein 7 from Arabidopsis with 36.84% of identity |
Eggnog | rho GTPase activating protein(ENOG410XR4E) |
Kegg | Link to kegg annotations (AT4G24580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416050.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer