Transcript | Ll_transcript_7109 |
---|---|
CDS coordinates | 358-1257 (+) |
Peptide sequence | MRIAIWDTFPEPNRYLLQRILLMMQAVASRKAENKMSSSAVAACMAPLLLRPLLAGDCEIENDFDVGGDGSVQLLQAAAAANHAQAICITLLEEYNSIFGEGSESPDIYTDTEESGSESEEATDDDLSYDDDEDYDDEEDGSVHESDVEDDLVSESYSETGESQGNDDKDHDGSGPSSKSSGASEEFKVIQPSKSLKGSRPQHQDIKSSENLTNLTKNACADQSNEPADIVGGVSTDHVTMDNSDFTSPPHIKKSMTMSNGGAPSPTPRRRTMLGRTSARKNLSMESIDFPIDDEDEIER |
ORF Type | 3prime_partial |
Blastp | Rho GTPase-activating protein REN1 from Arabidopsis with 48.44% of identity |
---|---|
Blastx | Rho GTPase-activating protein REN1 from Arabidopsis with 49.62% of identity |
Eggnog | rho GTPase activating protein(ENOG410XR4E) |
Kegg | Link to kegg annotations (AT4G24580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438510.1) |
Pfam | RhoGAP domain (PF00620.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer