Protein coding transcript 250868

• Transcript: Ll_transcript_6477
• CDS coordinates: 154-465 (+)
• Peptide sequence: MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYAGGVFLVSIHFPPDYPFKPPKVFYPSLLFLPTLVAYIVASYDVAFILRPVQLLFFILV*
• ORF Type: complete

Annotations of Ll_transcript_6477

• Blastp: Ubiquitin-conjugating enzyme E2-17 kDa from Lycopersicon with 78.41% of identity
• Blastx: Ubiquitin-conjugating enzyme E2-17 kDa from Lycopersicon with 78.41% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (100301932)
• CantataDB: Link to cantataDB annotations (CNT0002539)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461676.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;