Transcript | Ll_transcript_6453 |
---|---|
CDS coordinates | 187-498 (+) |
Peptide sequence | MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYAGGVFLVSIHFPPDYPFKPPKVFYPSLLFLPTLVAYIVASYDVAFILRPVQLLFFILV* |
ORF Type | complete |
Blastp | Ubiquitin-conjugating enzyme E2-17 kDa from Lycopersicon with 78.41% of identity |
---|---|
Blastx | Ubiquitin-conjugating enzyme E2-17 kDa from Lycopersicon with 78.41% of identity |
Eggnog | ubiquitin-conjugating enzyme(COG5078) |
Kegg | Link to kegg annotations (100301932) |
CantataDB | Link to cantataDB annotations (CNT0002539) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461676.1) |
Pfam | Ubiquitin-conjugating enzyme (PF00179.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer