Protein coding transcript 250879

• Transcript: Ll_transcript_6449
• CDS coordinates: 405-1040 (+)
• Peptide sequence: MLGAYSLLKVIESELQAYLTATEGRVGRCLALIQAASDVPEQGGVHDSDHFLHAIRDLLKVYSNTQAALSTYVSAPGIVQQISALHSDLTTLQSELENSLPEDRNRCINELCTLIQSLQQLLFASSTTAQPILTPRPLMKELDEMEKINAKLSAAVEEVTLEHVKKNEIVKHHSQEIGLQRRVFVDFFCNPERLRSQVRELTARVRALQIS*
• ORF Type: complete

Annotations of Ll_transcript_6449

• Blastp: AUGMIN subunit 3 from Arabidopsis with 79.15% of identity
• Blastx: Cytochrome f from Vicia with 94.38% of identity
• Eggnog: HAUS augmin-like complex subunit 3(ENOG4111N2F)
• Kegg: Link to kegg annotations (AT5G48520)
• CantataDB: Link to cantataDB annotations (CNT0000355)
• Mirbase: hbr-MIR6483 (MI0022062)
• Ncbi protein: Link to NCBI protein (YP_008963614.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;