Protein coding transcript 250883

• Transcript: Ll_transcript_6450
• CDS coordinates: 331-678 (+)
• Peptide sequence: MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYTGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_6450

• Blastp: SUMO-conjugating enzyme UBC9 from Arabidopsis with 98.28% of identity
• Blastx: SUMO-conjugating enzyme UBC9 from Arabidopsis with 98.28% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT4G27960)
• CantataDB: Link to cantataDB annotations (CNT0002933)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004490726.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;