Protein coding transcript 250891

• Transcript: Ll_transcript_8005
• CDS coordinates: 182-1075 (+)
• Peptide sequence: MPAVGSGARQFNDPHALAQLHQRSMNAAADQSRMTSSAVQNVGSNARNSQELDAKIESQGSQTSQLPPSSSNVVSQETERSSVHIQGLTKQQQQHLHFSSAHGSSGGNYNPFSGTTSSSISSINPQLLDSHLGQAPHQNTGQNHLGGATQGLNVIGMPKHQQQNSFSGPKRLPGGSVSSMVNNSAPQQTSNAGQPSINKEQKVGMLSSVSYVKKEPSDLSTEQQHRLNLSKLHGLHSVNSAQIEQGSANQGSVKDEFSRGLPASTNMPPTTFQHNSSASSSVMTQPNPSVSVSLRPI*
• ORF Type: complete

Annotations of Ll_transcript_8005

• Blastp: Transcription initiation factor TFIID subunit 4 from Arabidopsis with 29.52% of identity
• Blastx: Transcription initiation factor TFIID subunit 4b from Arabidopsis with 80% of identity
• Eggnog: RNA polymerase II, TATA box binding protein (TBP)-associated factor(ENOG410XQS6)
• Kegg: Link to kegg annotations (AT1G27720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429835.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;