Protein coding transcript 250904

• Transcript: Ll_transcript_7991
• CDS coordinates: 182-1267 (+)
• Peptide sequence: MPAVGSGARQFNDPHALAQLHQRSMNAAADQSRMTSSAVQNVGSNARNSQELDAKIESQGSQTSQLPPSSSNVVSQETERSSVHIQGLTKQQQQHLHFSSAHGSSGGNYNPFSGTTSSSISSINPQLLDSHLGQAPHQNTGQNHLGGATQGLNVIGMPKHQQQNSFSGPKRLPGGSVSSMVNNSAPQQTSNAGQPSINKEQKVGMLSSVSYVKKEPSDLSTEQQHRLNLSKLHGLHSVNSAQIEQGSANQGSVKDEFSRGLPASTNMPPTTFQHNSSASSSVMTQPNPSVSIPSNTSGIMARAPLKKPSLAQKKPLEALGSSPPPPSKKQKTSGGSVEQSIEQLNDVTAVSGVDLREEEEQL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_7991

• Blastp: Transcription initiation factor TFIID subunit 4b from Arabidopsis with 39.6% of identity
• Blastx: Transcription initiation factor TFIID subunit 4b from Arabidopsis with 39.6% of identity
• Eggnog: RNA polymerase II, TATA box binding protein (TBP)-associated factor(ENOG410XQS6)
• Kegg: Link to kegg annotations (AT5G43130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429835.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;