Protein coding transcript 25094

• Transcript: Ll_transcript_390621
• CDS coordinates: 221-562 (+)
• Peptide sequence: MCICTYYSLFKIGMLMFYSLTPRQTSSVNLLMICSMVARYAPPISYNFLNLIRLGPHKTTIFEQRMGNIDNAVPFFGDKFNRIYPLIMVIYTALVASNFFDRVFNFMGSWKRYI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_390621

• Blastp: LMBR1 domain-containing protein 2 homolog B from Dictyostelium with 26.61% of identity
• Blastx: LMBR1 domain-containing protein 2 homolog B from Dictyostelium with 29.27% of identity
• Eggnog: LMBR1 domain containing 2(ENOG410XR8P)
• Kegg: Link to kegg annotations (DDB_G0281669)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415518.1)
• Pfam: LMBR1-like membrane protein (PF04791.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;