Protein coding transcript 25098

• Transcript: Ll_transcript_390627
• CDS coordinates: 492-1190 (+)
• Peptide sequence: MWVFYLISLPLTLGMVIFPLRYFAGPDVPRYVLFTVGYTWLSSLSIIVLVPADIWATISSNHETGGISFFWSWSYWSTFLLTWAVAPLIQGFEDAGDFTVSERLKTSVHVNLIFYLILGSIGLIGLIILIMMRKTWTGSLLGLAMALSNTFGLVTGAFLLGFGLSEIPKSIWRNADQTTRQKVLSHKIAKMAVKLDNAHQDLSNAIVVSGSYMSVKFLCFGLFCSPNLYIQS*
• ORF Type: complete

Annotations of Ll_transcript_390627

• Blastp: LMBR1 domain-containing protein 2 homolog A from Dictyostelium with 36.49% of identity
• Blastx: LMBR1 domain-containing protein 2 homolog A from Dictyostelium with 37.29% of identity
• Eggnog: LMBR1 domain containing 2(ENOG410XR8P)
• Kegg: Link to kegg annotations (DDB_G0284019)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463615.1)
• Pfam: LMBR1-like membrane protein (PF04791.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;