Protein coding transcript 251077

• Transcript: Ll_transcript_6270
• CDS coordinates: 2-730 (+)
• Peptide sequence: NDLVKYVQTFLERTYERCRTSYMEAVLEKQSYMLIGRHDIEKLMRLDPSSAFLPNLPGQFNMESNSSDAETIEAELELSELLLNLRPIKQEYLIHDDNKLILLASLTDSLEYVADSIERLGQTTQKASNHVEGKYHHSHSDSAPARSLASFAQDYRKLAVDCLKVLRIEMQLETIFHMQEMSNTEYLDDQDAEEPDDFIISLTAQITRRDEEMAPFISNAKRNYIFGGICGVAAHTSIKALVD
• ORF Type: internal

Annotations of Ll_transcript_6270

• Blastp: Exocyst complex component SEC8 from Arabidopsis with 69.96% of identity
• Blastx: Exocyst complex component SEC8 from Arabidopsis with 69.96% of identity
• Eggnog: Exocyst complex component(ENOG410Z8N0)
• Kegg: Link to kegg annotations (AT3G10380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434380.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;