Protein coding transcript 2511

• Transcript: Ll_transcript_328913
• CDS coordinates: 3-425 (+)
• Peptide sequence: SKYLFQQVLNGGGSAAAQRLGQISLHIDPNQPGKISVEWANGVGASSGAEEAIQRQSQQSAGPVMTSGKNADSSDPAKVSKPNDIKDFKVPEKEFTLEEVAKHNKKEDLWIAVKGVVMDVTDWVEEHPGGPQALFSHMGRD
• ORF Type: internal

Annotations of Ll_transcript_328913

• Blastp: Cytochrome b5 from Oryza sativa with 50% of identity
• Blastx: Cytochrome b5 from Oryza sativa with 50% of identity
• Eggnog: cytochrome b5(COG5274)
• Kegg: Link to kegg annotations (4337583)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004494850.1)
• Pfam: Cytochrome b5-like Heme/Steroid binding domain (PF00173.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;