Transcript | Ll_transcript_328913 |
---|---|
CDS coordinates | 3-425 (+) |
Peptide sequence | SKYLFQQVLNGGGSAAAQRLGQISLHIDPNQPGKISVEWANGVGASSGAEEAIQRQSQQSAGPVMTSGKNADSSDPAKVSKPNDIKDFKVPEKEFTLEEVAKHNKKEDLWIAVKGVVMDVTDWVEEHPGGPQALFSHMGRD |
ORF Type | internal |
Blastp | Cytochrome b5 from Oryza sativa with 50% of identity |
---|---|
Blastx | Cytochrome b5 from Oryza sativa with 50% of identity |
Eggnog | cytochrome b5(COG5274) |
Kegg | Link to kegg annotations (4337583) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004494850.1) |
Pfam | Cytochrome b5-like Heme/Steroid binding domain (PF00173.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer