Protein coding transcript 251104

• Transcript: Ll_transcript_7699
• CDS coordinates: 2-361 (+)
• Peptide sequence: GKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQITSASIAGDHVLAAAYAHELPHFGLEVGLTNYAAAYCTGLLLARRVLKTLELDEEYEGNVEVPMDVTCSLFLPSAHHCHYL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_7699

• Blastp: 60S ribosomal protein L5-2 from Arabidopsis with 88.89% of identity
• Blastx: 60S ribosomal protein L5 from Cucumis with 76.01% of identity
• Eggnog: This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance (By similarity)(COG0256)
• Kegg: Link to kegg annotations (AT5G39740)
• CantataDB: Link to cantataDB annotations (CNT0000907)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456191.1)
• Pfam: Ribosomal large subunit proteins 60S L5, and 50S L18 (PF17144.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;