Protein coding transcript 251111

• Transcript: Ll_transcript_7714
• CDS coordinates: 2-469 (+)
• Peptide sequence: AAAYAHERPHFGLEVGLTNYAAAYCTGLLLARRVLKTLELDEDYEGNVEATGEDYSVEPAETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYDKEKKELDPEVHRKYIFGGHVANYIKTLIEDEPEKYQTHFSEYIKRGIE
• ORF Type: internal

Annotations of Ll_transcript_7714

• Blastp: 60S ribosomal protein L5 from Cucumis with 85.9% of identity
• Blastx: 60S ribosomal protein L5 from Cucumis with 85.9% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101216379)
• CantataDB: Link to cantataDB annotations (CNT0000907)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460221.1)
• Pfam: Ribosomal large subunit proteins 60S L5, and 50S L18 (PF17144.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;