Protein coding transcript 251137

• Transcript: Ll_transcript_7839
• CDS coordinates: 220-945 (+)
• Peptide sequence: MNSNESPKDPIPLDNRPGIFIIGSPNVGKRTLLSRLLSIDLEDASDSASEVNVHGWNISTKYYTADVSVWTANLHDDFSVRSLPIFQQLDALVMVFDMNDLSSLTALQNWVSCIDIQNFEILLCIGNKVDLIPGHPVHAEYRRRSMKLEDSAVDPYSEFAKYGISESEGTSLLGDEEPSGDIRRSCLEWCTENNIEFIEACASNADFDKCKPSLPLVVISCSCVNNMTFWLTIAHYSEFCFD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_7839

• Blastp: Ras-related protein Rab-12 from Rattus with 22.9% of identity
• Blastx: -
• Eggnog: member RAS oncogene family(ENOG410XPUI)
• Kegg: Link to kegg annotations (25530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445154.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;