Protein coding transcript 251179

• Transcript: Ll_transcript_7152
• CDS coordinates: 4160-5098 (+)
• Peptide sequence: MATKDFTNETKIVAPIQDTVADYSQEGHIGDANSLNDINNESAMESVAETDALSSGNAPSKKLGFGLVGSGKRTSVPSVFHEEEDDDAHKNKKLRPLVPIDYSTEELQAVQPTASGPTPPNLAAAAEFAKRISSASLKEEKLDGERDRSRRSNEKSTHRDRDKSDEDGTHRRDESRDKIPDRDRGRDHGLDKLKTSGNKRLLDAKQLIDMIPKTKDELFAYEINWSVYDKNQLHERMRPWISKKIEEFLGEEENTLIDYIVSSTQEHVKASQMLERLQMILDEEAEMFVLKMWRMLIFEIKKVETGLALRSK*
• ORF Type: complete

Annotations of Ll_transcript_7152

• Blastp: RNA-binding protein 25 from Homo with 48.08% of identity
• Blastx: RNA-binding protein 25 from Homo with 48.08% of identity
• Eggnog: RNA binding motif protein 25(ENOG410ZRGA)
• Kegg: Link to kegg annotations (58517)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423638.1)
• Pfam: PWI domain (PF01480.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;