Protein coding transcript 251191

• Transcript: Ll_transcript_7145
• CDS coordinates: 2635-3546 (+)
• Peptide sequence: MVRPLYPPRAPGSVNVLPVPRLPVAGVPAVRPVIPPVIRPVIVPSVTPAEKPQITVYIGKIAPTVENDFMLNLFQLCGPVKSWKRPQDLSNGTPKGFGFCEFESDEGVLRALRLLTKLSIDGQELTLNVNSTMKEYLKQYVEKKAENSKKNETQAVGAENDDGSAQPPDANGDGKPDAEHSKKEDNDSGNKESHDLATFGIITADDREADKEAIEKITNMIEERLKTRPLPIAPAQAAGDGSAIISEQPAKTRDGDTGVDMGGKGKIYCWPKTLPVLYISIDTIGLYLIVGVDIVLWKFIFSI*
• ORF Type: complete

Annotations of Ll_transcript_7145

• Blastp: RNA-binding protein 25 from Mus with 38.26% of identity
• Blastx: RNA-binding protein 25 from Mus with 48% of identity
• Eggnog: RNA binding motif protein 25(ENOG410ZRGA)
• Kegg: Link to kegg annotations (67039)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439187.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;