Protein coding transcript 2512

• Transcript: Ll_transcript_328997
• CDS coordinates: 141-743 (+)
• Peptide sequence: MAPRGTTTVVSVANNGVAASKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTPEEAARAYDAAAREFRGAKAKTNFSTPSEVMNISINNNTRSPSQSSTIDSSSPPPPLALALTPFSSAAADISYTPARPVMFFDVFARREVCGFYRPVAEFRRASTVTAGAKSNSDSSSVVDFPRVPRQKLLDLDLNVPPPPEVA*
• ORF Type: complete

Annotations of Ll_transcript_328997

• Blastp: Ethylene-responsive transcription factor 4 from Arabidopsis with 53.85% of identity
• Blastx: Ethylene-responsive transcription factor 4 from Arabidopsis with 83.1% of identity
• Eggnog: Transcription factor(ENOG410YQ8J)
• Kegg: Link to kegg annotations (AT3G15210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426172.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;