Protein coding transcript 251262

• Transcript: Ll_transcript_5229
• CDS coordinates: 867-1415 (+)
• Peptide sequence: MKLGLKLLQERAKVGSFWWPYISNLPETYSVPIFFPGEDIKNLQYAPLLHQVNKRCRFLLDLEQEIKRALVNLTPDKYPFGDQEVHASSLGWAMAAVSSRAFRLYGNKRPDGGHVEVPMMLPLIDMCNHSFNPNARIVQERDTDNTKMQVKVVAEREIKEDDPLLLNYGCLSNDFFLLDYGFV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_5229

• Blastp: Histone-lysine N-methyltransferase setd3 from Canis with 27.32% of identity
• Blastx: Histone-lysine N-methyltransferase setd3 from Canis with 27.32% of identity
• Eggnog: set domain containing(ENOG410Y7DR)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422533.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;