Protein coding transcript 251332

• Transcript: Ll_transcript_6164
• CDS coordinates: 54-365 (+)
• Peptide sequence: MLRFMSKHIMPPYGTPPHPYVAMYPHGGIYAHPSMPPGSYPFSPFAMPSNGIVEASGNTPGSMEADVVKPPEAKEKLPIKRSKGSLGSLNMITGKNNEHSKTTG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_6164

• Blastp: bZIP transcription factor 16 from Arabidopsis with 74.75% of identity
• Blastx: bZIP transcription factor 16 from Arabidopsis with 74.75% of identity
• Eggnog: Transcription factor(ENOG410Y53Y)
• Kegg: Link to kegg annotations (AT2G35530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423675.1)
• Pfam: G-box binding protein MFMR (PF07777.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;