Protein coding transcript 251345

• Transcript: Ll_transcript_6179
• CDS coordinates: 45-578 (+)
• Peptide sequence: MASWHQVPKPTHICGVSSGESASEGTSEGSDADSQNDSHLKSGGRQDSYEEEPSQNGSSAHASQNGGLNAPHTAVNQTMSIVPSPVSGTPGAVPGPTTNLNIGMDYWGAPASASIPELRGKVPSPAVAGGMVTGGSRDSVQSQRWLQVNFDKRPITSKSLITYYNCSINQVMIMQKN*
• ORF Type: complete

Annotations of Ll_transcript_6179

• Blastp: bZIP transcription factor 16 from Arabidopsis with 53.85% of identity
• Blastx: bZIP transcription factor 16 from Arabidopsis with 50.43% of identity
• Eggnog: Transcription factor(ENOG410Y53Y)
• Kegg: Link to kegg annotations (AT2G35530)
• CantataDB: Link to cantataDB annotations (CNT0000625)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423677.1)
• Pfam: Disordered region downstream of MFMR (PF16596.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;