Protein coding transcript 251372

• Transcript: Ll_transcript_5843
• CDS coordinates: 983-1312 (+)
• Peptide sequence: MNIGSHSPKIEKRTSRKNKPIIDNNAPLIPKTNPKSDAGFDDSNGASFYGAVINLSTTIIGAGVMSLPATLKELGMVPGLLAIIFMALLTEKSIEFMIRFSRAGNLTSYG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_5843

• Blastp: Amino acid transporter AVT6B from Arabidopsis with 55.56% of identity
• Blastx: Amino acid transporter AVT6B from Arabidopsis with 55.56% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT5G38820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442767.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;