Transcript | Ll_transcript_5569 |
---|---|
CDS coordinates | 557-2032 (+) |
Peptide sequence | MSSAGLSTLSPVPREPLLFPNGFHTPLHLNLDYESIFIYLSFSGSLTPMRVLACDTIESVKLKIKRSEGLPSLTNKQKLVCGGRELARSNSLLKDYGVTEGNVLHLVIRPTDLQTINVRTSCGKEFLFQLERFKDVGHVKQQIAKKEKRFADPEMQEVVCDGECLEDQWLIGDICCKNNVVIHLFVREKYAEVKTGMDELSIVATKLSDRKNNDVDGDNYRRKYDSSKEDTREYETVDQIVPRKSLDRDLLLEPIIVNPKVELASEIWNMIHFSYDGLDSGHYPIRSAEGTGGAYFMLDSTGQKYVSVFKPIDEEPMAVNNPRGLPLSLDGEGLKKGTRVGQGAFREVAAYILDHPISGHRSLCGDEKGFAGVPPTVMVKCLHKGFNHPGDLTAKIGSLQMFMENSGSCEDMGPGAFPVNEVHKITVLDMRLANADRHAGNILISKEEENGQAVLIPIDHGYCLPTSFEDCTFEWLYWPQARQPYSPETIDY |
ORF Type | 3prime_partial |
Blastp | Phosphatidylinositol 4-kinase gamma 4 from Arabidopsis with 57.06% of identity |
---|---|
Blastx | Phosphatidylinositol 4-kinase gamma 4 from Arabidopsis with 57.06% of identity |
Eggnog | Phosphatidylinositol 4-kinase type(ENOG410XP06) |
Kegg | Link to kegg annotations (AT2G46500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456298.1) |
Pfam | Ubiquitin family (PF00240.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer