Protein coding transcript 251377

• Transcript: Ll_transcript_5570
• CDS coordinates: 643-2094 (+)
• Peptide sequence: MSSAGLSTLSPVPREPLLFPNGFYTPLHFALDYESIFIYLSFSGSLTPLRVLPCDTIESVKLKIKKSEGLHLLTNKQKLVYGGRELARSNSLLKDYGVTEGNVLHLVIRLSDLQTINVRTSCGKEFLFQLERFKDVGHVKQQIAKKEKRFADPEMQEVVCDGECLEDQWLIGDICCKNNVVIHLFVREKYAEVKTGMDELSIVATKLSDRKNNDVDGDNYRRKYDSSKEDTREYETVDQIVPRKSLDRDLLLEPIIVNPKVELASEIWNMINSSYDGLDSGHYPFQSAEGTGGAYFMLDSTGQKYVSVFKPIDEEPMAVNNPRGLPLSLDGEGLKKGTRVGQGALREVAAYLLDHPISGHRSLFGDEKGFAGVAPTIMAKCLHKGFNHPGDLTAKIGSLQMFVENSGSCEDMGPGAFPVKEVHKITVLDMRLANADRHAGNILISKEEENGQAVLIPIDHGYCLPTSVSTLLSHPLLMHVMAL*
• ORF Type: complete

Annotations of Ll_transcript_5570

• Blastp: Phosphatidylinositol 4-kinase gamma 4 from Arabidopsis with 55.84% of identity
• Blastx: Phosphatidylinositol 4-kinase gamma 4 from Arabidopsis with 55.84% of identity
• Eggnog: Phosphatidylinositol 4-kinase type(ENOG410XP06)
• Kegg: Link to kegg annotations (AT2G46500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429049.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;