Protein coding transcript 251391

• Transcript: Ll_transcript_5183
• CDS coordinates: 1-390 (+)
• Peptide sequence: HRLIWDAFGSYMGKKDEGNLVNGGCGFRPDSKTVVCVQGLSAVMASGVSAIVTMPFDTIKTRLQVLDSEENGRRRPLTLVQTVKNLVNEGGLLACYRGLGPRWASMSMSATTMITTYEFLKRMSTKSQE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_5183

• Blastp: Mitochondrial carrier protein RIM2 from Saccharomyces with 34.09% of identity
• Blastx: Mitochondrial carrier protein RIM2 from Saccharomyces with 38.81% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YBR192W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417126.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;