Protein coding transcript 251392

• Transcript: Ll_transcript_5193
• CDS coordinates: 1109-1750 (+)
• Peptide sequence: MAAQLVWTPIDVVSQRIMVQGCNSSTNTKNIVNNLNSENYRNGFDAFRKILCADGAKGLYRGFGISILTYAPSNAVWWTSYSVVHRLIWDAFGSYMGKRDDGNLVNRGYGFRPDSKAMVAVQGLSAVMASGVSAIMTMPFDTVKTRLQVLDSEESGRRRPLTFVQSVKSLVNEGGLLACYRGIGPRWASMSMSATTMITTYEFLKRVSTKSQE*
• ORF Type: complete

Annotations of Ll_transcript_5193

• Blastp: Solute carrier family 25 member 44 from Mus with 29.3% of identity
• Blastx: Solute carrier family 25 member 44 from Mus with 28.96% of identity
• Eggnog: Solute carrier family 25 member(ENOG410XTGQ)
• Kegg: Link to kegg annotations (229517)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437833.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;