Transcript | Ll_transcript_6135 |
---|---|
CDS coordinates | 86-742 (+) |
Peptide sequence | MAIDHEINAPLNSLTVHRNYHNDDGASGSRRISSSPENFTLGENSPIEQVALTVPVTDDPSLPTLTFRTWFLGSLACVLLSFLNQFFGYRREPLSVTAVSAQIAVVPLGHLMAATVTKRVFWKGKKFEFTLNPGKFNVKEHVLITIFANSGAASVYAVHFVTGVKVFYRKDVSLWVAMLAVLTTQVLGFGWAGIFRKYLVEPAAMWWPQNLVQVSLFR* |
ORF Type | complete |
Blastp | Oligopeptide transporter 7 from Arabidopsis with 75.29% of identity |
---|---|
Blastx | Oligopeptide transporter 7 from Arabidopsis with 75% of identity |
Eggnog | oligo-peptide transporter(ENOG410XNZC) |
Kegg | Link to kegg annotations (AT4G10770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424367.1) |
Pfam | OPT oligopeptide transporter protein (PF03169.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer