Protein coding transcript 25144

• Transcript: Ll_transcript_391028
• CDS coordinates: 1974-2279 (+)
• Peptide sequence: MSIIVPVAVFVLGVAAGLEVMSCRMLLIMSVISFGVLVASYGEININWVGVVYQMGGVVGEALRLIFMEIFVKRKGLKLNPISVMYYVSPFRQVLPFQNFS*
• ORF Type: complete

Annotations of Ll_transcript_391028

• Blastp: Probable sugar phosphate/phosphate translocator At3g14410 from Arabidopsis with 80.41% of identity
• Blastx: Probable sugar phosphate/phosphate translocator At3g14410 from Arabidopsis with 83.33% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: Link to kegg annotations (AT3G14410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454469.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;