Transcript | Ll_transcript_6142 |
---|---|
CDS coordinates | 673-981 (+) |
Peptide sequence | MKKRKKGKLPKEARQQLLEWWSRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKPSDEMPFYSNMVDPNHSQYYMDNVLTHPFNFPMDLSNTML* |
ORF Type | complete |
Blastp | Homeobox protein SBH1 from Soja with 80.22% of identity |
---|---|
Blastx | Homeobox protein SBH1 from Soja with 82.24% of identity |
Eggnog | homeobox(ENOG410XPMQ) |
Kegg | Link to kegg annotations (547796) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424728.1) |
Pfam | Homeobox KN domain (PF05920.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer