Protein coding transcript 251451

• Transcript: Ll_transcript_6145
• CDS coordinates: 673-975 (+)
• Peptide sequence: MKKRKKGKLPKEARQQLLEWWSRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKPSEDMPFYSNMMDPNHPQYYMDNVMSHPFPMDLSNTML*
• ORF Type: complete

Annotations of Ll_transcript_6145

• Blastp: Homeobox protein SBH1 from Soja with 85.39% of identity
• Blastx: Homeobox protein SBH1 from Soja with 85.33% of identity
• Eggnog: homeobox(ENOG410XPMQ)
• Kegg: Link to kegg annotations (547796)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424728.1)
• Pfam: Homeobox KN domain (PF05920.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;