Protein coding transcript 251455

• Transcript: Ll_transcript_6216
• CDS coordinates: 253-771 (-)
• Peptide sequence: GNKAKIINRNKNWNPQKVQYVKSPANNDSGNSFTCFRCGKSGHMARKCRNKPMNRPPQANMVDEPFVVVLSEVTMVGGTNGWWVDIGASRHVCYDRAMFKNYTDVDDKKVLLGDRHTTFVAETGDVKLKFTYGKTLILKDVMHTPEMSKNLVFFSTKLVLPRIYEQTCILLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_6216

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 28.66% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 28.66% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004516287.1)
• Pfam: Zinc knuckle (PF13917.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;