Transcript | Ll_transcript_6013 |
---|---|
CDS coordinates | 475-1065 (+) |
Peptide sequence | MKLCTSCLFISTLSLCLLASATVPPNEAWGLTSLREAIYEDPYLVFSNWNTLDSDPCDWFGVSCTMAGDHVLKLNISGSSLRGFLVQELGQITYLQELILHGNNLIGTIPKELGMLRSLKVLDLGKNQLSGPIPPEIGNITLLVNINLQSNGLTGRLPEELGNLRYLQELRLDRNRLEGSVPASSSLNFDSNMHEM* |
ORF Type | complete |
Blastp | Probable LRR receptor-like serine/threonine-protein kinase At1g63430 from Arabidopsis with 57.98% of identity |
---|---|
Blastx | Probable LRR receptor-like serine/threonine-protein kinase At1g63430 from Arabidopsis with 62.72% of identity |
Eggnog | LRR receptor-like serine threonine-protein kinase(ENOG410YEY6) |
Kegg | Link to kegg annotations (AT1G63430) |
CantataDB | Link to cantataDB annotations (CNT0001813) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444897.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer