Protein coding transcript 251513

• Transcript: Ll_transcript_6013
• CDS coordinates: 475-1065 (+)
• Peptide sequence: MKLCTSCLFISTLSLCLLASATVPPNEAWGLTSLREAIYEDPYLVFSNWNTLDSDPCDWFGVSCTMAGDHVLKLNISGSSLRGFLVQELGQITYLQELILHGNNLIGTIPKELGMLRSLKVLDLGKNQLSGPIPPEIGNITLLVNINLQSNGLTGRLPEELGNLRYLQELRLDRNRLEGSVPASSSLNFDSNMHEM*
• ORF Type: complete

Annotations of Ll_transcript_6013

• Blastp: Probable LRR receptor-like serine/threonine-protein kinase At1g63430 from Arabidopsis with 57.98% of identity
• Blastx: Probable LRR receptor-like serine/threonine-protein kinase At1g63430 from Arabidopsis with 62.72% of identity
• Eggnog: LRR receptor-like serine threonine-protein kinase(ENOG410YEY6)
• Kegg: Link to kegg annotations (AT1G63430)
• CantataDB: Link to cantataDB annotations (CNT0001813)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444897.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;