Protein coding transcript 251552

• Transcript: Ll_transcript_5097
• CDS coordinates: 1-822 (+)
• Peptide sequence: EADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHDLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTAKMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_5097

• Blastp: 26S proteasome regulatory subunit 6B homolog from Arabidopsis with 98.17% of identity
• Blastx: 26S proteasome regulatory subunit 6B homolog from Arabidopsis with 98.17% of identity
• Eggnog: 26S protease regulatory subunit(COG1222)
• Kegg: Link to kegg annotations (AT5G58290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419657.1)
• Pfam: AAA domain (dynein-related subfamily) (PF07728.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;