Transcript | Ll_transcript_5104 |
---|---|
CDS coordinates | 743-1114 (+) |
Peptide sequence | MDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTANMNLGDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK* |
ORF Type | complete |
Blastp | 26S proteasome regulatory subunit 6B homolog from Solanum with 98.37% of identity |
---|---|
Blastx | 26S proteasome regulatory subunit 6B homolog from Solanum with 98.37% of identity |
Eggnog | 26S protease regulatory subunit(COG1222) |
Kegg | Link to kegg annotations (102577768) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419657.1) |
Pfam | ATPase family associated with various cellular activities (AAA) (PF00004.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer