Protein coding transcript 251556

• Transcript: Ll_transcript_5109
• CDS coordinates: 1-465 (+)
• Peptide sequence: EADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHDLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQVFTS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_5109

• Blastp: 26S proteasome regulatory subunit 6B homolog from Helianthus with 98.68% of identity
• Blastx: 26S proteasome regulatory subunit 6B homolog from Helianthus with 98.68% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013460491.1)
• Pfam: Protein of unknown function (DUF815) (PF05673.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;