Protein coding transcript 251613

• Transcript: Ll_transcript_5861
• CDS coordinates: 182-1189 (+)
• Peptide sequence: MIQSFSAAKTNWLELQSKLVSRKHSQSNVCVAGEAVNVNIEFKNPLQIAIPVSGVTLICKHSAITDEVRLDENKSVVGDDNDIDHFKDMSSNNSSILMSEVDFLLGGGETTMVQLSVTPRVEGTLEILGFRWKLSGTIVGFHKFELSLPKHIVKSRRKGKRSPNDKFKFIVIKSIPKLEASINSLPGKAYAGDLRQLVLELKNPSEFPVKNLKMKISHPRFLIIGNQEDIKSEFPACLTKKIDSGQSDAHANRSILSDTVFLFPEGTSVQGQTPFLWPLWFRAAVPGEISLYLSIYYEMEDISSVIKYRTLRLHYNVQVLPSLDVSFQISPSRLRI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_5861

• Blastp: Trafficking protein particle complex subunit 8 from Homo with 21.93% of identity
• Blastx: Trafficking protein particle complex subunit 8 from Homo with 22.37% of identity
• Eggnog: trafficking protein particle complex(ENOG410XPCJ)
• Kegg: Link to kegg annotations (22878)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444202.1)
• Pfam: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit (PF08626.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;