Transcript | Ll_transcript_7443 |
---|---|
CDS coordinates | 1797-2225 (+) |
Peptide sequence | MPLGTAIHNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKRNKYSDNLILRRRSK* |
ORF Type | complete |
Blastp | 50S ribosomal protein L2, chloroplastic from Carica with 100% of identity |
---|---|
Blastx | 50S ribosomal protein L2, chloroplastic from Cucumis with 98.47% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | osa-MIR5538 (MI0019059) |
Ncbi protein | Link to NCBI protein (XP_003605908.1) |
Pfam | Ribosomal Proteins L2, C-terminal domain (PF03947.17) |
Rfam | tRNA (RF00005) |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer